PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0104400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 635aa    MW: 69198.5 Da    PI: 5.2268
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0104400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS363.43.3e-1112606342374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      + Ll+cA+ v+s d  la + L +++  +s  gdpm+R+a+yf +AL +rl+  s ++ ++  +++++ +++ +e + ++k++++++P+ kf+h
  Spipo2G0104400 260 LQSLLDCARLVDS-DPDLAAKSLVQIRASSSDFGDPMERVAFYFSKALYSRLSLeSLQSHSSPSRSRSSFDYSPEEFILSYKALNDACPYSKFAH 353
                     689******9988.89999999******************************98455666666666666667799******************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                     ltaNqaIle++e + r+HiiDf+i qG+QW+aLlqaLa+R++g+p ++Ri g+ +p+ g   + +l +tg+rL++fA+ l+++fef++ v + ++
  Spipo2G0104400 354 LTANQAILESTEAAARIHIIDFGIVQGVQWAALLQALATRSSGKPaKIRISGIPAPALGdyPTAALAATGNRLRDFAALLDLDFEFDP-VLTPIQ 447
                     *****************************************77666**********999999**************************.799*** PP

            GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     +l+l+++r+  +Ea+aVn++lql++ll e+ +  +   ++L++ k ++P+vv++ e e+++n+ +Fl+rf +al+yy+a+f+sle  + r+s er
  Spipo2G0104400 448 ELTLSSFRLAADEAVAVNFMLQLYNLLGETSEAVE---RILRIAKAIRPTVVTLGEYEVSLNKVDFLQRFGNALSYYAAVFESLEPAMERDSLER 539
                     ***************************66666666...9******************************************************** PP

            GRAS 283 ikvErellgreivnvv.acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                       vEr l+gr+i+ +  + eg++r +r+e+ ++Wr+r+e +GF++v+ls++a++qa  ll +++ s+ y++ +++  ++ l W +rpL+svSaWr
  Spipo2G0104400 540 LRVERLLFGRRIMAAAgSWEGRDRCARMEERAQWRARMEGSGFESVALSHYAVSQAGILLWNYNySERYSLVDSEPGFLsLAWCGRPLLSVSAWR 634
                     ************99873679********************************************9999**9988877777**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.594233612IPR005202Transcription factor GRAS
PfamPF035141.1E-108260634IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MAYICSADSG NLMAIAQQVI QQKQQQQQQQ QQQHQQHQQS HHHQHQPQQH QQNQMATVNP  60
FGLPPWGANH GFPFADAGFS DPFQADAGGA AVLGFVAPPL PMDHGAFRLS DYGNSTIASA  120
AGGGDFDTDE WMESLIGEST AESSELIGDT WPADAGHEFA PLFGDAFASC SSSPDDLNRV  180
FFSEPQKNPS TVAHHAVTSP PLAHQIQAQG WTPAPPPPLP PPREASTGPA KKHPPPPPPP  240
TTTTTTMTTG KTDSPAAPLL QSLLDCARLV DSDPDLAAKS LVQIRASSSD FGDPMERVAF  300
YFSKALYSRL SLESLQSHSS PSRSRSSFDY SPEEFILSYK ALNDACPYSK FAHLTANQAI  360
LESTEAAARI HIIDFGIVQG VQWAALLQAL ATRSSGKPAK IRISGIPAPA LGDYPTAALA  420
ATGNRLRDFA ALLDLDFEFD PVLTPIQELT LSSFRLAADE AVAVNFMLQL YNLLGETSEA  480
VERILRIAKA IRPTVVTLGE YEVSLNKVDF LQRFGNALSY YAAVFESLEP AMERDSLERL  540
RVERLLFGRR IMAAAGSWEG RDRCARMEER AQWRARMEGS GFESVALSHY AVSQAGILLW  600
NYNYSERYSL VDSEPGFLSL AWCGRPLLSV SAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1562566341375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008790358.10.0PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 4
SwissprotQ9FL031e-162SCL4_ARATH; Scarecrow-like protein 4
TrEMBLM0SJ670.0M0SJ67_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P30530_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85693748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-149GRAS family protein